compare

Comparison List

amilGFP

amilGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora millepora.
+
amilGFP Spectrum Fluorescent protein amilGFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 26.0 kDa -

FPbase ID: 8TF9W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
503 512 75,200 0.67 50.38      

Photostability

No photostability measurements available ... add one!

amilGFP Sequence

MSYSKHGIVQEMKTKYHMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPAGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHKSIFHGVNFPADGPVMKKKTIDWDKSFEKMTVSKEVLRGDVTMFLMLEGGGSHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVK
GenBank: AY646067

Excerpts

No excerpts have been added for amilGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Overcoming chromoprotein limitations by engineering a red fluorescent protein

    Bao L, Menon Pnk, Liljeruhm J, Forster Ac

    (2020). Analytical Biochemistry, 611, 113936. doi: 10.1016/j.ab.2020.113936. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change