compare

Comparison List

amilGFP

amilGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora millepora.
+
Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 26.0 kDa -

FPbase ID: 8TF9W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
503 512 75,200 0.67 50.38      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

amilGFP Sequence

BLAST
MSYSKHGIVQEMKTKYHMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPAGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHKSIFHGVNFPADGPVMKKKTIDWDKSFEKMTVSKEVLRGDVTMFLMLEGGGSHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVK
GenBank: AY646067

Excerpts

No excerpts have been added for amilGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and Evolution of Coral Fluorescent Proteins

Alieva No, Konzen Ka, Field Sf, Meleshkevitch Ea, Hunt Me, Beltran-Ramirez V, Miller Dj, Wiedenmann J, Salih A, Matz Mv

(2008). PLoS ONE, 3(7) , e2680. doi: 10.1371/journal.pone.0002680. Article   Pubmed

Additional References

  1. Overcoming chromoprotein limitations by engineering a red fluorescent protein

    Bao L, Menon Pnk, Liljeruhm J, Forster Ac

    (2020). Analytical Biochemistry, 611, 113936. doi: 10.1016/j.ab.2020.113936. Article   Pubmed

  2. Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology

    Liljeruhm J, Funk Sk, Tietscher S, Edlund Ad, Jamal S, Wistrand-Yuen P, Dyrhage K, Gynnå A, Ivermark K, Lövgren J, Törnblom V, Virtanen A, Lundin Er, Wistrand-Yuen E, Forster Ac

    (2018). Journal of Biological Engineering, 12(1) , . doi: 10.1186/s13036-018-0100-0. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change