compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Achilles

This protein has unmoderated changes.

Achilles is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2020, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.8 kDa	-

FPbase ID: MLHQR

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
513	525	110,000	0.64	70.4	5.5

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Achilles Sequence

Achilles was derived from Venus with the following mutations: S31R/Y40I/Q70A/C71V/I129S/D130G/Y146F/A207FS30R/Y39I/Q69A/C70V/I128S/D129G/Y145F/A206F
amino acid numbers relative to VenusavGFP. show relative to avGFP show relative to Venus

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKLICTTGKLPVPWPTLVTTLGYGLAVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGSGFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSFLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

GenBank: LC381432

Excerpts

No excerpts have been added for Achilles
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Coupling delay controls synchronized oscillation in the segmentation clock

Yoshioka-Kobayashi K, Matsumiya M, Niino Y, Isomura A, Kori H, Miyawaki A, Kageyama R

(2020). Nature, , . doi: 10.1038/s41586-019-1882-z. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Achilles

Change history

Something missing or incorrect? Submit a change Submit a change