compare

Comparison List

Achilles

Achilles is a basic (constitutively fluorescent) fluorescent protein published in 2020, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: MLHQR

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Achilles Sequence

Achilles was derived from Venus with the following mutations: S30R/Y39I/Q69A/C70V/I128S/D129G/Y145F/A206F
amino acid numbers relative to avGFP. show relative to Venus

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKLICTTGKLPVPWPTLVTTLGYGLAVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGSGFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSFLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: LC381432

Excerpts

No excerpts have been added for Achilles
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Coupling delay controls synchronized oscillation in the segmentation clock

Yoshioka-Kobayashi K, Matsumiya M, Niino Y, Isomura A, Kori H, Miyawaki A, Kageyama R

(2020). Nature, , . doi: 10.1038/s41586-019-1882-z. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change