compare

Comparison List

h2-3

h2-3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2020, derived from Ricordea sp. FP2-3. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Ricordea sp. FP2-3 26.5 kDa -

FPbase ID: YQ25V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506 516 130,000 0.89 115.7 4.6    

Photostability

No photostability measurements available ... add one!

h2-3 Sequence

MSKLQKGVEKEMKIKLTMNCTVNERNFVITGQGAGEPYDGTQTLYLTVEGGKTLNFSFDVLTPAFQYGNRAFTKYPGNIPDFFKQTFSGGGYTWKRTMTYEDGGVSTVESDISVQGDCFHYKIQFNGKFPPHGPVMQKETVKWEPSTEVMYKDDKNDGVLKGDVNMALLLKDGGHLRVDFNTSYIPKNKVEKMPDYHFVDHRIEILEKPEGRPVKLYAGAVARYSLLPEKNLNK
GenBank: BBC08820

Excerpts

No excerpts have been added for h2-3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change