compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

YGFPuv

a.k.a. CP_YGFPuv

This protein has unmoderated changes.

YGFPuv is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2017, derived from Chiridius poppei.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Dimer	Chiridius poppei	24.7 kDa	-

FPbase ID: VAQHD

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
398	512	8,800	0.81	7.13

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

YGFPuv Sequence

BLAST

YGFPuv was derived from CpYGFP with the following mutations: H52T/R154YH52T/R154Y

MTTFKIESRIHGNLNGEKFELVGGGVGEEGRLEIEMKTKDKPLAFSPFLLSTCMGYGFYHFASFPKGTKNIYLHAATNGGYTNTRKEIYEDGGILEVNFRYTYEFNKIIGDVECIGHGFPSQSPIFKDTIVKSCPTVDLMLPMSGNIIASSYAYAFQLKDGSFYTAEVKNNIDFKNPIHESFSKSGPMFTHRRVEETHTKENLAMVEYQQVFNSAPRDM

GenBank: BBA07590

IPG: BBA07590.1

Excerpts

No excerpts have been added for YGFPuv
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Molecular evolution of versatile derivatives from a GFP-like protein in the marine copepod Chiridius poppei

Shimizu A, Shiratori I, Horii K, Waga I

(2017). PLOS ONE, 12(7) , e0181186. doi: 10.1371/journal.pone.0181186. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for YGFPuv
Search RIKEN BRC for YGFPuv

Change history

Something missing or incorrect? Submit a change Submit a change