compare

Comparison List

CpYGFP

CpYGFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2006, derived from Chiridius poppei.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Chiridius poppei 24.7 kDa -

FPbase ID: RK5BV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 518 101,000 0.53 53.53      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

CpYGFP Sequence

BLAST
MTTFKIESRIHGNLNGEKFELVGGGVGEEGRLEIEMKTKDKPLAFSPFLLSHCMGYGFYHFASFPKGTKNIYLHAATNGGYTNTRKEIYEDGGILEVNFRYTYEFNKIIGDVECIGHGFPSQSPIFKDTIVKSCPTVDLMLPMSGNIIASSYARAFQLKDGSFYTAEVKNNIDFKNPIHESFSKSGPMFTHRRVEETHTKENLAMVEYQQVFNSAPRDM
GenBank: AB185173
UniProtKB: Q2MHN7
IPG: BAE78442

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for CpYGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A novel yellowish-green fluorescent protein from the marine copepod, Chiridius poppei, and its use as a reporter protein in HeLa cells

Masuda H, Takenaka Y, Yamaguchi A, Nishikawa S, Mizuno H

(2006). Gene, 372, 18-25. doi: 10.1016/j.gene.2005.11.031. Article   Pubmed

Additional References

  1. Molecular evolution of versatile derivatives from a GFP-like protein in the marine copepod Chiridius poppei

    Shimizu A, Shiratori I, Horii K, Waga I

    (2017). PLOS ONE, 12(7) , e0181186. doi: 10.1371/journal.pone.0181186. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change