compare

Comparison List

dUltramarine2

dUltramarine2 is a basic (constitutively fluorescent) fluorescent protein published in 2016, derived from Montipora efflorescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Montipora efflorescens 24.9 kDa -

FPbase ID: UL6ZA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
587   81,500 0.0001 0.01      

Photostability

No photostability measurements available ... add one!

dUltramarine2 Sequence

dUltramarine2 was derived from Ultramarine with the following mutations: N112S/T115I/F147V/R158H/K202R

MSVIATQMTYKVYMSGTVNGHYFEVEGDGKGRPYEGEQTAKLTVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGSCFIYHVKFRGTNFPPNGPVMQKKTQGWEPNSERLVARGGMLIGNNHMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNRDYTSVEQCEISIARKPVVA

Excerpts

No excerpts have been added for dUltramarine2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change