compare

Comparison List

Ultramarine

Ultramarine is a basic (constitutively fluorescent) red fluorescent protein published in 2012, derived from Montipora efflorescens.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Montipora efflorescens 24.9 kDa -

FPbase ID: 3F18R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
586 626 64,000 0.001 0.06   108.0 1.6

Photostability

No photostability measurements available ... add one!

Ultramarine Sequence

Ultramarine was derived from mRtms5 with the following mutations: L123T/H142N

MSVIATQMTYKVYMSGTVNGHYFEVEGDGKGRPYEGEQTAKLTVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGFTWERIMNFEDGAVCTVSNDSSIQGNCFTYHVKFRGTNFPPNGPVMQKKTQGWEPNSERLFARGGMLIGNNRMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA

Excerpts

No excerpts have been added for Ultramarine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change