compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mEos4Fast1

a.k.a. mEos4b-A60Q-L93M

This protein has unmoderated changes.

mEos4Fast1 is a photoconvertible red fluorescent protein published in 2025, derived from Lobophyllia hemprichii. It has high acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Lobophyllia hemprichii	26.0 kDa	-

FPbase ID: TP5Z2

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Green	505	517	93,170	0.78	72.67	5.6	64.0
Red	570	580	58,450	0.73	42.67	6.7

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

mEos4Fast1 Sequence

BLAST

mEos4Fast1 was derived from mEos4b-L93M with the following mutations: A61QA60Q
amino acid numbers relative to mEos4b-L93MEosFP. show relative to EosFP show relative to mEos4b-L93M

MVSAIKPDMRIKLRMEGNVNGHHFVIDGDGTGKPYEGKQTMDLEVKEGGPLPFAFDILTTQFHYGNRVFVKYPDNIQDYFKQSFPKGYSWERSMTFEDGGICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

Introducing the single A60Q mutation resulted in maturation times of 209 ± 13 min for mEos4b-A60Q and 64 ± 5 min for mEos4b-A60Q-L93M. We named this fast-maturing double mutant mEos4Fast1.

Maity et al. (2025)

Primary Reference

Decoding mEos4b day‐long maturation and engineering fast‐maturing variants

Maity A, Glushonkov O, Ayala I, Tacnet P, Wulffelé J, Frachet P, Brutscher B, Bourgeois D, Adam V

(2025). Protein Science, 34(8) , e70234. doi: 10.1002/pro.70234. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mEos4Fast1
Search RIKEN BRC for mEos4Fast1

Change history

Something missing or incorrect? Submit a change Submit a change