compare

Comparison List

CyOFP1

CyOFP1 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2016, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: TL112

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
497 589 40,000 0.76 30.4 5.5 15.0 3.6
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
111.0   Chu et al. (2016)
A caution on interpretation of photostability measurements
Add photostability info

CyOFP1 Sequence

BLAST

CyOFP1 was derived from mNeptune2 with the following mutations: H10R/M11S/M15L/T18S/N21G/H23Q/S28H/T38K/G41N/C61H/T68_I76delinsVFIKYPADL/F79Y/T94M/T95V/Y96F/V104A/C114E/L121V/S128A/A142P/L147M/M160K/C172V/L174F/R179K/A184_N186del/L187V/Y193H/F194Y/H214Y/V216H/C222_N230cdelinsSNLGG
amino acid numbers relative to eqFP578. show relative to mNeptune2

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTNRIKVVEGGPLPFAFDILATHFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKVRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKALKLVGGGHLHVNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK
GenBank: KU530233

Excerpts

No excerpts have been added for CyOFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A bright cyan-excitable orange fluorescent protein facilitates dual-emission microscopy and enhances bioluminescence imaging in vivo

Chu J, Oh Y, Sens A, Ataie N, Dana H, Macklin Jj, Laviv T, Welf Es, Dean Km, Zhang F, Kim Bb, Tang Ct, Hu M, Baird Ma, Davidson Mw, Kay Ma, Fiolka R, Yasuda R, Kim Ds, Ng H-L, Lin Mz

(2016). Nature Biotechnology, 34(7) , 760-767. doi: 10.1038/nbt.3550. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change