compare

Comparison List

CyOFP1

CyOFP1 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2016, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.
+
CyOFP1 Spectrum Fluorescent protein CyOFP1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: TL112

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
497 589 40,000 0.76 30.4 5.5 15.0 3.6

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
111.0   Chu et al. (2016)

CyOFP1 Sequence

CyOFP1 was derived from mNeptune2 with the following mutations: H10R/M11S/M15L/T18S/N21G/H23Q/S28H/T38K/G41N/C61H/T68_I76delinsVFIKYPADL/F79Y/T94M/T95V/Y96F/V104A/C114E/L121V/S128A/A142P/L147M/M160K/C172V/L174F/R179K/A184_N186del/L187V/Y193H/F194Y/H214Y/V216H/C222_N230cdelinsSNLGG
amino acid numbers relative to eqFP578. show relative to mNeptune2

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTNRIKVVEGGPLPFAFDILATHFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKVRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKALKLVGGGHLHVNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK
GenBank: KU530233

Excerpts

No excerpts have been added for CyOFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change