compare

Comparison List

afCFP

a.k.a. TOLLES

afCFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2020, derived from Galaxea fascicularis. It has very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Galaxea fascicularis 25.7 kDa -

FPbase ID: TDOH1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
406 499 30,000 0.79 23.7 2.0    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

afCFP Sequence

BLAST

afCFP was derived from mAzamiGreen with the following mutations: M1_S2insV/T58S/V60S/T82A/S142D/R149E/A160R/F173V/D182E/R184S/V191I/K199E/Y210C/Y217A

MVSVIKPEMKIKLCMRGTVNGHNFVIEGEGKGNPYEGTQILDLNVTEGAPLPFAYDILSTSFQYGNRAFTKYPADIQDYFKQAFPEGYHWERSMTYEDQGICTATSNISMRGDCFFYDIRFDGTNFPPNGPVMQKKTLKWEPDTEKMYVEDGVLKGDVNMRLLLEGGGHYRCDVKTTYKAKKEVSLPDAHKIDHRIEILEHDKDYNKVKLCENAVARASMLPSQAK

Excerpts

No excerpts have been added for afCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Visualizing and Modulating Mitophagy for Therapeutic Studies of Neurodegeneration

Katayama H, Hama H, Nagasawa K, Kurokawa H, Sugiyama M, Ando R, Funata M, Yoshida N, Homma M, Nishimura T, Takahashi M, Ishida Y, Hioki H, Tsujihata Y, Miyawaki A

(2020). Cell, 181(5) , 1176-1187.e16. doi: 10.1016/j.cell.2020.04.025. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change