compare

Comparison List

hmKeima8.5

hmKeima8.5 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2015, derived from Montipora sp. 20. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Montipora sp. 20 25.1 kDa -

FPbase ID: Q92FU

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
438 612 32,000 0.34 10.88 5.3 228.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

hmKeima8.5 Sequence

BLAST

hmKeima8.5 was derived from mKeima with the following mutations: K6E/Q7H/K30E/D55H/E73A/E90V/Q110R/L146M/Y158H/T176A/K180R/R188L/H189Y/C210R/S218P
amino acid numbers relative to Montipora sp. #20. show relative to mKeima

MVSVIAEHMTYKVYMSGTVNGHYFEVEGDGEGKPYEGEQTVKLTVTKGGPLPFAWHILSPQLQYGSIPFTKYPADIPDYFKQSFPEGYTWVRSMNFEDGAVCTVSNDSSIRGNCFIYNVKISGENFPPNGPVMQKKTQGWEPSTERMFARDGMLIGNDHMALKLEGGGHYLCEFKSAYKARKPVRMPGLYEIDRKLDVTSHNRDYTSVEQREIAIARHPLLG

Excerpts

No excerpts have been added for hmKeima8.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Live-cell multiphoton fluorescence correlation spectroscopy with an improved large Stokes shift fluorescent protein

Guan Y, Meurer M, Raghavan S, Rebane A, Lindquist Jr, Santos S, Kats I, Davidson Mw, Mazitschek R, Hughes Te, Drobizhev M, Knop M, Shah Jv

(2015). Molecular Biology of the Cell, 26(11) , 2054-2066. doi: 10.1091/mbc.e14-10-1473. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change