compare

Comparison List

mKG

mKG is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Verrillofungia concinna.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Verrillofungia concinna 24.4 kDa -

FPbase ID: PS1S2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 507          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mKG Sequence

BLAST
MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPFAFDLVSHVFAYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHRLVRKTEGNITELVEDAVAHS
GenBank: BAF76140
UniProtKB: A7VMR3
IPG: 13707795

Excerpts

No excerpts have been added for mKG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Sequential Binding of Cytosolic Phox Complex to Phagosomes through Regulated Adaptor Proteins: Evaluation Using the Novel Monomeric Kusabira-Green System and Live Imaging of Phagocytosis

Ueyama T, Kusakabe T, Karasawa S, Kawasaki T, Shimizu A, Son J, Leto Tl, Miyawaki A, Saito N

(2008). The Journal of Immunology, 181(1) , 629-640. doi: 10.4049/jimmunol.181.1.629. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change