compare

Comparison List

mPA-GFP

similar: PA-GFP

mPA-GFP is a fluorescent protein published in 2002, derived from Aequorea victoria. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: NPU85

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mPA-GFP Sequence

mPA-GFP was derived from PA-GFP with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to PA-GFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mPA-GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Photoactivatable GFP for Selective Photolabeling of Proteins and Cells

Patterson Gh

(2002). Science, 297(5588) , 1873-1877. doi: 10.1126/science.1074952. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change