compare

Comparison List

DimVenus

DimVenus is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2013, derived from Aequorea victoria.
+
DimVenus Spectrum Fluorescent protein DimVenus excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: NOX8W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 525 55,400 0.03 1.66      

Photostability

No photostability measurements available ... add one!

DimVenus Sequence

DimVenus was derived from Venus with the following mutations: Y145W
amino acid numbers relative to avGFP. show relative to Venus

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNWNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for DimVenus
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highlighted Ca2+ imaging with a genetically encoded ‘caged’ indicator

Matsuda T, Horikawa K, Saito K, Nagai T

(2013). Scientific Reports, 3(1) , 1398. doi: 10.1038/srep01398. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change