compare

Comparison List

Kohinoor2.0

Kohinoor2.0 is a photoswitchable green fluorescent protein published in 2021, derived from Echinophyllia sp. SC22. It is reported to be a very rapidly-maturing protein.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Echinophyllia sp. SC22 25.2 kDa -

FPbase ID: L1ZEW

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 500 516 31,200 0.607 18.94   14.7  
Edit States/Attributes
Edit state transitions

Photostability

No photostability measurements available ... add one!

Kohinoor2.0 Sequence

BLAST

Kohinoor2.0 was derived from Kohinoor with the following mutations: M40V/L153V/S162L/R170L/L185M/Y188N/E214V

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSVDLKVKEGGPLPFAYDILTMAFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMIYEDGGICIATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVVKSDGNYALLLEGGGHYLCDSKTTYKAKKVVQMPDNHDVVHHIEIKSHDRDYSNVNLHEHAVAHSGLPRQAK

Excerpts

No excerpts have been added for Kohinoor2.0
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A photoswitchable fluorescent protein for hours-time-lapse and sub-second-resolved super-resolution imaging

Wazawa T, Noma R, Uto S, Sugiura K, Washio T, Nagai T

(2021). Microscopy, , . doi: 10.1093/jmicro/dfab001. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change