compare

Comparison List

RDSmCherry0.1

RDSmCherry0.1 is a basic (constitutively fluorescent) red fluorescent protein published in 2017, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.6 kDa -

FPbase ID: JVYE5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 625 59,600 0.1 5.96      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

RDSmCherry0.1 Sequence

BLAST

RDSmCherry0.1 was derived from mCherry with the following mutations: I161G/Q163G
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEGKGRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for RDSmCherry0.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering of mCherry variants with long Stokes shift, red-shifted fluorescence, and low cytotoxicity

Shen Y, Chen Y, Wu J, Shaner Nc, Campbell Re

(2017). PLOS ONE, 12(2) , e0171257. doi: 10.1371/journal.pone.0171257. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change