compare

Comparison List

htFuncLib_mid.2

htFuncLib_mid.2 is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 28.3 kDa -

FPbase ID: FLXJ6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
476 510 0.45   4.99   1.17

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
27.7 22.7 (mW) LED Widefield Weinstein et al. (2022)

htFuncLib_mid.2 Sequence

MGSSHHHHHHVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGCYKIRAEVKFEGDTLVNRIELHGIDFKEDGNILGHKLEYNINSHNVYIMPDKQNNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDYHYLHTWSELSKDPNEKRDHMVLLEFVEAAGITLGMDELYK

Excerpts

No excerpts have been added for htFuncLib_mid.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change