compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

rsKame

This protein has unmoderated changes.

rsKame is a photoswitchable green fluorescent protein published in 2014, derived from Echinophyllia sp. SC22.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Echinophyllia sp. SC22	25.5 kDa	-

FPbase ID: D87D7

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Off
On	503	517	72,000	0.86	61.92

Edit States/Attributes

Transitions

From	To	Switch λ
Off	On	405
On	Off	488

Edit state transitions

Photostability

No photostability measurements available ... add one!

rsKame Sequence

BLAST

rsKame was derived from Dronpa with the following mutations: V157LV157L

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDLNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

No excerpts have been added for rsKame
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Optimized two-color super resolution imaging of Drp1 during mitochondrial fission with a slow-switching Dronpa variant

Rosenbloom Ab, Lee S-H, To M, Lee A, Shin Jy, Bustamante C

(2014). Proceedings of the National Academy of Sciences, 111(36) , 13093-13098. doi: 10.1073/pnas.1320044111. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for rsKame
Search RIKEN BRC for rsKame

Change history

Something missing or incorrect? Submit a change Submit a change