compare

Comparison List

Sirius

a.k.a. UMFP-4

Sirius is a basic (constitutively fluorescent) uv fluorescent protein published in 2009, derived from Aequorea victoria. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: BU5R3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
355 424 15,000 0.24 3.6 3.0    
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
0.00000979   Tomosugi et al. (2009)
A caution on interpretation of photostability measurements
Add photostability info

Sirius Sequence

BLAST
MVSKGEELFTGVVPILVELDGDVNGHRFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLQFGVLCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNGISSNVYITADKQKNGIKAHFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSVQSKLSKDPNEKRDHMVLLESVTAAGITLGMDELYK
GenBank: BAH29934
IPG: 16773179

Excerpts

No excerpts have been added for Sirius
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An ultramarine fluorescent protein with increased photostability and pH insensitivity

Tomosugi W, Matsuda T, Tani T, Nemoto T, Kotera I, Saito K, Horikawa K, Nagai T

(2009). Nature Methods, 6(5) , 351-353. doi: 10.1038/nmeth.1317. Article   Pubmed

Additional References

  1. A streptococcal NRAMP homologue is crucial for the survival of<i>S</i><i>treptococcus agalactiae</i>under low pH conditions

    Shabayek S, Bauer R, Mauerer S, Mizaikoff B, Spellerberg B

    (2016). Molecular Microbiology, 100(4) , 589-606. doi: 10.1111/mmi.13335. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change