compare

Comparison List

mOFP.T.12

mOFP.T.12 is a fluorescent protein published in 2004, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: B55T2

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mOFP.T.12 Sequence

BLAST

mOFP.T.12 was derived from mOFP.T.8 with the following mutations: K194M/D196S
amino acid numbers relative to DsRed. show relative to mOFP.T.8

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYMVSIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mOFP.T.12
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein

Shaner Nc, Campbell Re, Steinbach Pa, Giepmans Bng, Palmer Ae, Tsien Ry

(2004). Nature Biotechnology, 22(12) , 1567-1572. doi: 10.1038/nbt1037. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change