compare

Comparison List

E2-Orange

E2-Orange is a basic (constitutively fluorescent) orange fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a somewhat slowly-maturing tetramer with low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Discosoma sp. 25.7 kDa -

FPbase ID: A3B6M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
540 561 36,500 0.54 19.71 4.5 78.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
81.0   Strack et al. (2009)
A caution on interpretation of photostability measurements
Add photostability info

E2-Orange Sequence

BLAST

E2-Orange was derived from DsRed-Express2 with the following mutations: Q66T/V71A/S179T

MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGEGEGKPYEGTQTAKLQVTKGGPLPFAWDILSPQFTYGSKAYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGTFIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERLYPRDGVLKGEIHKALKLKGGGHYLVEFKTIYMAKKPVKLPGYYYVDSKLDITSHNEDYTVVEQYERAEARHHLFQ
GenBank: FJ498891

Excerpts

No excerpts have been added for E2-Orange
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Noncytotoxic orange and red/green derivatives of DsRed-Express2 for whole-cell labeling

Strack Rl, Bhattacharyya D, Glick Bs, Keenan Rj

(2009). BMC Biotechnology, 9(1) , 32. doi: 10.1186/1472-6750-9-32. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change