compare

Comparison List

DsRed-Express2

DsRed-Express2 is a basic (constitutively fluorescent) orange fluorescent protein published in 2008, derived from Discosoma sp.. It is reported to be a rapidly-maturing protein.
+
Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 25.7 kDa -

FPbase ID: 5DP2R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
554 591 35,600 0.42 14.95   42.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
64.0   Strack et al. (2008)

DsRed-Express2 Sequence

DsRed-Express2 was derived from DsRed-Express with the following mutations: A2D/S4T/D6N/E10P/R17H/R36K/K47Q/S117T/K121H/M141L/A145P/D169G/Q188K/I210V/G219A/L225Q

MDSTENVIKPFMRFKVHMEGSVNGHEFEIEGEGEGKPYEGTQTAKLQVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGTFIYHVKFIGVNFPSDGPVMQKKTLGWEPSTERLYPRDGVLKGEIHKALKLKGGGHYLVEFKSIYMAKKPVKLPGYYYVDSKLDITSHNEDYTVVEQYERAEARHHLFQ
GenBank: ACJ05619
IPG: 15756136

Excerpts

No excerpts have been added for DsRed-Express2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change