compare

Comparison List

Aquamarine

Aquamarine is a basic (constitutively fluorescent) cyan fluorescent protein published in 2013, derived from Aequorea victoria. It has very low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: 963OH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
430 474 26,000 0.89 23.14 3.3   4.1
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Aquamarine Sequence

BLAST

Aquamarine was derived from ECFP with the following mutations: T65S/H148G
amino acid numbers relative to avGFP. show relative to ECFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISGNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Aquamarine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Minimum set of mutations needed to optimize cyan fluorescent proteins for live cell imaging

Erard M, Fredj A, Pasquier H, Beltolngar D-B, Bousmah Y, Derrien V, Vincent P, Merola F

(2013). Mol. BioSyst., 9(2) , 258-267. doi: 10.1039/c2mb25303h. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change