compare

Comparison List

mGarnet2

mGarnet2 is a basic (constitutively fluorescent) red fluorescent protein published in 2017, derived from Entacmaea quadricolor. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.3 kDa -

FPbase ID: 7DP3C

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 671 105,000 0.087 9.13 6.8   0.76

Photostability

No photostability measurements available ... add one!

mGarnet2 Sequence

mGarnet2 was derived from mGarnet with the following mutations: V121L/S171H

MNSLIKENMRMKVVLEGSVNGHQFKCTGEGEGNPYMGTQTMRIKVIEGGPLPFAFDILATSFMYGSKTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGVITVMQDTSLEDGCLVYHAQLRGVNFPSNGAVMQKKTKGWEPNTEMMYPADGGLRGYNHMALKVDGGGHLHCSLVTTYRSKKTVGNIKMPGIHAVDRRLERLEESDNEMFVVQREHAVAKFAGLGGG

Excerpts

No excerpts have been added for mGarnet2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change