compare

Comparison List

mGarnet

mGarnet is a basic (constitutively fluorescent) red fluorescent protein published in 2015, derived from Entacmaea quadricolor. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.2 kDa -

FPbase ID: AE8QV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 670 95,000 0.09 8.55 7.4 112.0 0.8

Photostability

No photostability measurements available ... add one!

mGarnet Sequence

mGarnet was derived from mRuby with the following mutations: R67K/T158N/F174L/H197R

MNSLIKENMRMKVVLEGSVNGHQFKCTGEGEGNPYMGTQTMRIKVIEGGPLPFAFDILATSFMYGSKTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGVITVMQDTSLEDGCLVYHAQVRGVNFPSNGAVMQKKTKGWEPNTEMMYPADGGLRGYNHMALKVDGGGHLSCSLVTTYRSKKTVGNIKMPGIHAVDRRLERLEESDNEMFVVQREHAVAKFAGLGGG

Excerpts

No excerpts have been added for mGarnet
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change