compare

Comparison List

mClavGR2

mClavGR2 is a photoconvertible green fluorescent protein published in 2010, derived from Clavularia sp.. It is reported to be a rapidly-maturing monomer with high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.1 kDa -

FPbase ID: 6LRFZ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 488 504 19,000 0.77 14.63 8.0 27.0  
Red 566 583 32,000 0.53 16.96 7.3    

Transitions

From To Switch λ
Green Red 405

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Green 17.0  
Red 175.0  

mClavGR2 Sequence

mClavGR2 was derived from mClavGR1.8 with the following mutations: E165T
amino acid numbers relative to cFP484. show relative to mClavGR1.8

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICIATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEASTEKMYVRDGVLKGDVKMKLLLKGGGHYRCDFRTTYKVKQKAVKLPDYHFVDHRIEILSHDKDYNKVKLYEHAVAHSGLPGMDELYK

Excerpts

No excerpts have been added for mClavGR2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Monomeric Photoconvertible Fluorescent Protein for Imaging of Dynamic Protein Localization

Hoi H, Shaner Nc, Davidson Mw, Cairo Cw, Wang J, Campbell Re

(2010). Journal of Molecular Biology, 401(5) , 776-791. doi: 10.1016/j.jmb.2010.06.056. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change