compare

Comparison List

H9

H9 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1994, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

FPbase ID: 59R1F

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 20,000 0.6 12.0      

Photostability

No photostability measurements available ... add one!

H9 Sequence

H9 was derived from avGFP with the following mutations: S202F/T203I

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLFIQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for H9
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Wavelength mutations and posttranslational autoxidation of green fluorescent protein.

Heim R, Prasher Dc, Tsien Ry

(1994). Proceedings of the National Academy of Sciences, 91(26) , 12501-12504. doi: 10.1073/pnas.91.26.12501. Article

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change