compare

Comparison List

dCyRFP2s

dCyRFP2s is a basic (constitutively fluorescent) yellow fluorescent protein published in 2021, derived from Entacmaea quadricolor. It is reported to be a somewhat slowly-maturing dimer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 54XX1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
516 592 42,000 0.58 24.36 5.44 75.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

dCyRFP2s Sequence

BLAST

dCyRFP2s was derived from mCyRFP1 with the following mutations: N8S/T27I/E114G/N129Y/K161L/K179R
amino acid numbers relative to eqFP578. show relative to mCyRFP1

MVSKGEELIKESMRSKLYLEGSVNGHQFKCIHEGEGKPYEGKQTARIKVVEGGPLPFAFDILATMFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGGLIYNVKLRGVNFPAYGPVMQKKTLGWEPSTETMYPADGGLEGRCDKLLKLVGGGHLHVNFKTTYRSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK

Excerpts

No excerpts have been added for dCyRFP2s
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

LSSmScarlet, dCyRFP2s, dCyOFP2s and CRISPRed2s, Genetically Encoded Red Fluorescent Proteins with a Large Stokes Shift

Subach Om, Vlaskina Av, Agapova Yk, Dorovatovskii Pv, Nikolaeva Ay, Ivashkina Oi, Popov Vo, Piatkevich Kd, Khrenova Mg, Smirnova Ta, Boyko Km, Subach Fv

(2021). International Journal of Molecular Sciences, 22(23) , 12887. doi: 10.3390/ijms222312887. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change