compare

Comparison List

KCY-G4219

KCY-G4219 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2009, derived from Verrillofungia concinna.
+
KCY-G4219 Spectrum Fluorescent protein KCY-G4219 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Verrillofungia concinna 24.8 kDa -

FPbase ID: 3KHK4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
453 486 21,100 0.8 16.88      

Photostability

No photostability measurements available ... add one!

KCY-G4219 Sequence

MSVIKPEMKMRYRMDGSVNGHEFTVEGEGTGRPYEGKHKITLDVTKGGPLPFAFDLLSTVFSYGNRALTKYPDDIPDYFKQCFPGGYSWERKFEFEDGGLAIAKAEISLKGNCFEHKSTIEGTFPDSSPIMQNKTLGWEPSTEKMTVRDGSMKGDDAAYLKLVGGGNHKCYFTTTYTAKKKIPNLPKSHFIGHRISSVVEGTKIKVMEDAIAHLYPFNGSPCQ

Excerpts

No excerpts have been added for KCY-G4219
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change