compare

Comparison List

Montipora sp. #20

a.k.a. meffCP-like

no. 20, is a violet-colored chromoprotein that does not fluoresce. It was isolated from Montipora sp. and used in the development of the Keima family of proteins.
+
Oligomerization Organism Molecular Weight Cofactor
? Montipora sp. 20 25.0 kDa -

FPbase ID: 2TW6P

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
             

Photostability

No photostability measurements available ... add one!

Montipora sp. #20 Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMHFEDGAVCTVSNDSSIQGNCFIYNVKISGVNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNKDYTFVEQCEISIARHSLLG

Excerpts

No excerpts have been added for Montipora sp. #20
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change