compare

Comparison List

sREACh1

sREACh1 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2017, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

FPbase ID: 2A3U4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
518 530 114,000 0.03 3.42      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

sREACh1 Sequence

BLAST

sREACh1 was derived from sREACh with the following mutations: N144A/N146P/S147V/A206K/R223F
amino acid numbers relative to avGFP. show relative to sREACh

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYAWPVVNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for sREACh1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

ShadowY: a dark yellow fluorescent protein for FLIM-based FRET measurement

Murakoshi H, Shibata Ace

(2017). Scientific Reports, 7(1) , 6791. doi: 10.1038/s41598-017-07002-4. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change