compare

Comparison List

sREACh

a.k.a. super-REACh, improved non-radiative YFP

sREACh is a basic (constitutively fluorescent) yellow fluorescent protein published in 2008, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: UOJ8M

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
517 531 115,000 0.07 8.05      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

sREACh Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNWNSVNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLERVTAAGITLGMDELYK

Excerpts

No excerpts have been added for sREACh
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highly sensitive and quantitative FRET–FLIM imaging in single dendritic spines using improved non-radiative YFP

Murakoshi H, Lee S-J, Yasuda R

(2008). Brain Cell Biology, 36(1-4) , 31-42. doi: 10.1007/s11068-008-9024-9. Article   Pubmed

Additional References

  1. Characterization of a spectrally diverse set of fluorescent proteins as FRET acceptors for mTurquoise2

    Mastop M, Bindels Ds, Shaner Nc, Postma M, Gadella Twj, Goedhart J

    (2017). Scientific Reports, 7(1) , 11999. doi: 10.1038/s41598-017-12212-x. Article   Pubmed

  2. A dark green fluorescent protein as an acceptor for measurement of Förster resonance energy transfer

    Murakoshi H, Shibata Ace, Nakahata Y, Nabekura J

    (2015). Scientific Reports, 5(1) , . doi: 10.1038/srep15334. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change