compare

Comparison List

ZsGreen

a.k.a. zFP506, zoanGFP

ZsGreen is a basic (constitutively fluorescent) green fluorescent protein published in 1999, derived from Zoanthus sp..
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Zoanthus sp. 26.1 kDa -

FPbase ID: W8LAG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 506 35,600 0.63 22.43      

Photostability

No photostability measurements available ... add one!

ZsGreen Sequence

MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAINLCVVEGGPLPFAEDILSAAFNYGNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAVCICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKGDVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEHAIASGSALP
GenBank: AAF03372
UniProtKB: Q9U6Y5
IPG: 380058

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for ZsGreen
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change