compare

Comparison List

ZsGreen

a.k.a. zFP506, zoanGFP

ZsGreen is a basic (constitutively fluorescent) green fluorescent protein published in 1999, derived from Zoanthus sp..
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Zoanthus sp. 26.1 kDa -

FPbase ID: W8LAG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 506 35,600 0.63 22.43      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

ZsGreen Sequence

BLAST
MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAINLCVVEGGPLPFAEDILSAAFNYGNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAVCICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKGDVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEHAIASGSALP
GenBank: AAF03372
UniProtKB: Q9U6Y5
IPG: 380058

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for ZsGreen
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Erratum: Fluorescent proteins from nonbioluminescent Anthozoa species

Matz Mv, Fradkov Af, Labas Ya, Savitsky Ap, Zaraisky Ag, Markelov Ml, Lukyanov Sa

(1999). Nature Biotechnology, 17(10) , 969-973. doi: 10.1038/13657. Article   Pubmed

Additional References

  1. Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

    Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

    (2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

  2. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change