compare

Comparison List

zoan2RFP

a.k.a. zoanRFP

zoan2RFP is a basic (constitutively fluorescent) orange fluorescent protein published in 2002, derived from Zoanthus sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Zoanthus sp. 26.4 kDa -

FPbase ID: HGZ48

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
552 576          

Photostability

No photostability measurements available ... add one!

zoan2RFP Sequence

MAHSKHGLTDDMTMHFRMEGCVDGHKFVIEGNGNGNPFKGKQFINLCVIEGGPLPFSEDILSAAFDYGNRLFTEYPEGIVDYFKNSCPAGYTWHRSFRFEDGAVCICSADITVNVRENCIYHESTFYGVNFPADGPVMKKMTTNWEPSCEKIIPINSQKILKGDVSMYLLLKDGGRYRCQFDTIYKAKTEPKEMPDWHFIQHKLNREDRSDAKNQKWQLIEHAIASRSALP
GenBank: AAL23574
UniProtKB: Q8T4U4
IPG: 1112201

Excerpts

No excerpts have been added for zoan2RFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change