compare

Comparison List

YGFPdp

a.k.a. CP_YGFP "dual-peak"

YGFPdp is a basic (constitutively fluorescent) green fluorescent protein published in 2017, derived from Chiridius poppei.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Chiridius poppei 24.7 kDa -

FPbase ID: B1GJH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
502 513 17,300 0.7 12.11      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

YGFPdp Sequence

BLAST

YGFPdp was derived from CpYGFP with the following mutations: H52C/S133Q/R154L

MTTFKIESRIHGNLNGEKFELVGGGVGEEGRLEIEMKTKDKPLAFSPFLLSCCMGYGFYHFASFPKGTKNIYLHAATNGGYTNTRKEIYEDGGILEVNFRYTYEFNKIIGDVECIGHGFPSQSPIFKDTIVKQCPTVDLMLPMSGNIIASSYALAFQLKDGSFYTAEVKNNIDFKNPIHESFSKSGPMFTHRRVEETHTKENLAMVEYQQVFNSAPRDM
GenBank: BBA07589.1
IPG: BBA07589.1

Excerpts

No excerpts have been added for YGFPdp
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Molecular evolution of versatile derivatives from a GFP-like protein in the marine copepod Chiridius poppei

Shimizu A, Shiratori I, Horii K, Waga I

(2017). PLOS ONE, 12(7) , e0181186. doi: 10.1371/journal.pone.0181186. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change