compare

Comparison List

yEGFP

a.k.a. yEGFP2, yEGFP3, yeast-enhanced GFP

yEGFP is a fluorescent protein published in 1997.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? <add one> 26.9 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

yEGFP Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: LC005521.1

Excerpts

"a codon-optimized and fluorescence-enhanced version of GFP [that] can be used as an efficient reporter in S. cerevisiae and C. albicans."

Cormack et al. (1997)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change