compare

Comparison List

yEGFP

a.k.a. yEGFP2, yEGFP3, yeast-enhanced GFP

yEGFP is a fluorescent protein published in 1997.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? <add one> 26.9 kDa -

FPbase ID: YHQTQ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

yEGFP Sequence

BLAST
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: LC005521.1

Excerpts

"a codon-optimized and fluorescence-enhanced version of GFP [that] can be used as an efficient reporter in S. cerevisiae and C. albicans."

Cormack et al. (1997)

Primary Reference

Yeast-enhanced green fluorescent protein (yEGFP): a reporter of gene expression in Candida albicans

Cormack Bp, Bertram G, Egerton M, Gow Nar, Falkow S, Brown Ajp

(1997). Microbiology, 143(2) , 303-311. doi: 10.1099/00221287-143-2-303. Article   Pubmed

Additional References

  1. Expression of varied GFPs in Saccharomyces cerevisiae: codon optimization yields stronger than expected expression and fluorescence intensity

    Kaishima M, Ishii J, Matsuno T, Fukuda N, Kondo A

    (2016). Scientific Reports, 6(1) , 35932. doi: 10.1038/srep35932. Article   Pubmed

  2. GFP as a quantitative reporter of gene regulation inCandida albicans

    Barelle Cj, Manson Cl, Maccallum Dm, Odds Fc, Gow Nar, Brown Ajp

    (2004). Yeast, 21(4) , 333-340. doi: 10.1002/yea.1099. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change