compare

Comparison List

vsGFP

a.k.a. very‐stable GFP

vsGFP is a fluorescent protein published in 2014, derived from Aequorea victoria. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: 35L95

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

vsGFP Sequence

BLAST

vsGFP was derived from Superfolder GFP with the following mutations: N164Y

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKAYFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for vsGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rapid directed evolution of stabilized proteins with cellular high-throughput encapsulation solubilization and screening (CHESS)

Yong Kj, Scott Dj

(2014). Biotechnology and Bioengineering, 112(3) , 438-446. doi: 10.1002/bit.25451. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change