compare

Comparison List

vsfGFP-9

a.k.a. vGFP, vsfGFP

vsfGFP-9 is a basic (constitutively fluorescent) green fluorescent protein published in 2015, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 39.5 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 510 104,958 0.7 73.47 4.75    

Photostability

no photostability measurements available ... add one!

vsfGFP-9 Sequence

vsfGFP-9 was derived from Superfolder GFP with the following mutations: *237AextQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTV
amino acid numbers relative to avGFP. show relative to Superfolder GFP

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS

Excerpts

No excerpts have been added for vsfGFP-9
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Structure-Based Design of Bright GFP-Based Complexes with Tunable Dimerization

Eshaghi M, Sun G, Grüter A, Lim Cl, Chee Yc, Jung G, Jauch R, Wohland T, Chen Sl

(2015). Angewandte Chemie International Edition, 54(47) , 13952-13956. doi: 10.1002/anie.201506686. Article   Pubmed

Additional References

  1. Brighter Fluorescent Derivatives of UTI89 Utilizing a Monomeric vGFP

    Eshaghi M, Mehershahi K, Chen S

    (2016). Pathogens, 5(1) , 3. doi: 10.3390/pathogens5010003. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change