compare

Comparison List

vsfGFP-0

a.k.a. dimeric vsfGFP, vGFP-0

vsfGFP-0 is a basic (constitutively fluorescent) green fluorescent protein published in 2015, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 38.4 kDa -

FPbase ID: BH9MB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 510 209,916 0.76 159.54 4.84    

Photostability

No photostability measurements available ... add one!

vsfGFP-0 Sequence

vsfGFP-0 was derived from Superfolder GFP with the following mutations: T230_K238delinsAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGIAQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVS

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for vsfGFP-0
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Structure-Based Design of Bright GFP-Based Complexes with Tunable Dimerization

Eshaghi M, Sun G, Grüter A, Lim Cl, Chee Yc, Jung G, Jauch R, Wohland T, Chen Sl

(2015). Angewandte Chemie International Edition, 54(47) , 13952-13956. doi: 10.1002/anie.201506686. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change