compare

Comparison List

usGFP

a.k.a. ultra-stable GFP

usGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2014, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.8 kDa -

FPbase ID: V3NZ1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 508 103,000 0.45 46.35      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

usGFP Sequence

BLAST

usGFP was derived from Superfolder GFP with the following mutations: Q69L/N164Y

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVLCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKAYFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for usGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rapid directed evolution of stabilized proteins with cellular high-throughput encapsulation solubilization and screening (CHESS)

Yong Kj, Scott Dj

(2014). Biotechnology and Bioengineering, 112(3) , 438-446. doi: 10.1002/bit.25451. Article   Pubmed

Additional References

  1. A Novel Ultra-Stable, Monomeric Green Fluorescent Protein For Direct Volumetric Imaging of Whole Organs Using CLARITY

    Scott Dj, Gunn Nj, Yong Kj, Wimmer Vc, Veldhuis Na, Challis Lm, Haidar M, Petrou S, Bathgate Rad, Griffin Mdw

    (2018). Scientific Reports, 8(1) , 667. doi: 10.1038/s41598-017-18045-y. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change