compare

Comparison List

UnaG

UnaG is a basic (constitutively fluorescent) green fluorescent protein published in 2013, derived from Anguilla japonica. It has low acid sensitivity. It requires the cofactor bilirubin for fluorescence.
+
Aggregation Organism Molecular Weight Cofactor
? Anguilla japonica 15.6 kDa Bilirubin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
498 527 77,300 0.51 39.42 4.0    

Photostability

no photostability measurements available ... add one!

UnaG Sequence

MVEKFVGTWKIADSHNFGEYLKAIGAPKELSDGGDATTPTLYISQKDGDKMTVKIENGPPTFLDTQVKFKLGEEFDEFPSDRRKGVKSVVNLVGEKLVYVQKWDGKETTYVREIKDGKLVVTLTMGDVVAVRSYRRATE
GenBank: BAN57322

Structure

Deposited: ,
Chromophore:

Excerpts

On heterologous expression in cell lines or mouse brain, UnaG produces oxygen-independent green fluorescence. Remarkably, UnaG fluorescence is triggered by an endogenous ligand, bilirubin, a membrane-permeable heme metabolite and clinical health biomarker... Therefore, unlike GFP, the green fluorescence of UnaG is not limited to aerobic conditions, suggesting that UnaG should have expansive utility in many important cell and animal systems in which anaerobic conditions prevail and GFP signals are not capable of being produced.

Kumagai et al. (2013)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change