compare

Comparison List

tsPurple

a.k.a. TinselPurple

tsPurple is a basic (constitutively fluorescent) fluorescent protein published in 2018, derived from synthetic construct.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? synthetic construct 25.5 kDa -

FPbase ID: N6AXC

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

tsPurple Sequence

MASLVKKDMCVKMTMEGTVNGYHFKCVGEGEGKPFEGTQNMRIRVTEGGPLPFAFDILAPCCMYGSKTFIKHVSGIPDYFKESFPEGFTWERTQIFEDGGVLTAHQDTSLEGNCLIYKVKVLGTNFPANGPVMQKKTAGWEPCVEMLYPRDGVLCGQSLMALKCTDGNHLTSHLRTTYRSRKPSNAVNMPEFHFGDHRIEILKAEQGKFYEQYESAVARYSDVPEKAT

Excerpts

No excerpts have been added for tsPurple
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change