compare

Comparison List

Superfolder pHluorin

Superfolder pHluorin is a multistate fluorescent protein published in 2018, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: 92266

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Superfolder pHluorin Sequence

Superfolder pHluorin was derived from Superfolder GFP with the following mutations: T65S/S147E/N149L/I161T/N164I/K166Q/I167V/R168H/S202H

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNEHLVYITADKQKNGTKAIFQVHHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for Superfolder pHluorin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change