compare

Comparison List

Superfolder mTurquoise2

a.k.a. sfTq2

Superfolder mTurquoise2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2019, derived from Aequorea victoria.
+
Superfolder mTurquoise2 Spectrum Fluorescent protein Superfolder mTurquoise2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: NFBGR

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 474          

Superfolder mTurquoise2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
87.0 - - Meiresonne et al. (2019)

Photostability

No photostability measurements available ... add one!

Superfolder mTurquoise2 Sequence

Superfolder mTurquoise2 was derived from mTurquoise2 with the following mutations: S30R/Y39N/F99S/N105T/I171V
amino acid numbers relative to avGFP. show relative to mTurquoise2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYFSDNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Superfolder mTurquoise2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change