compare

Comparison List

Superfolder GFP

a.k.a. sfGFP

Superfolder GFP is a basic (constitutively fluorescent) green fluorescent protein published in 2005, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: B4SOW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 510 83,300 0.65 54.15      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Superfolder GFP Sequence

BLAST
MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: ASL68970
IPG: 154375264

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for Superfolder GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering and characterization of a superfolder green fluorescent protein

Pédelacq J-D, Cabantous S, Tran T, Terwilliger Tc, Waldo Gs

(2005). Nature Biotechnology, 24(1) , 79-88. doi: 10.1038/nbt1172. Article   Pubmed

Additional References

  1. Synthetic Biology of Proteins: Tuning GFPs Folding and Stability with Fluoroproline

    Steiner T, Hess P, Bae Jh, Wiltschi B, Moroder L, Budisa N

    (2008). PLoS ONE, 3(2) , e1680. doi: 10.1371/journal.pone.0001680. Article   Pubmed

  2. A Comparison of the Fluorescence Dynamics of Single Molecules of a Green Fluorescent Protein: One- versus Two-Photon Excitation

    Cotlet M, Goodwin Pm, Waldo Gs, Werner Jh

    (2006). ChemPhysChem, 7(1) , 250-260. doi: 10.1002/cphc.200500247. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change