compare

Comparison List

super-TagRFP

a.k.a. stagRFP

super-TagRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2020, derived from Entacmaea quadricolor.
+
super-TagRFP Spectrum Fluorescent protein super-TagRFP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

FPbase ID: QJV5C

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
555 579 113,000 0.53 59.89     2.5

super-TagRFP OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
30.4 (23 cells) - HeLa Mo et al. (2020)

Photostability

No photostability measurements available ... add one!

super-TagRFP Sequence

super-TagRFP was derived from TagRFP-T with the following mutations: D159V
amino acid numbers relative to eqFP578. show relative to TagRFP-T

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRTVMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: EU582019.1
IPG: EU582019.1

Excerpts

No excerpts have been added for super-TagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A rationally enhanced red fluorescent protein expands the utility of FRET biosensors

Mo Gch, Posner C, Rodriguez Ea, Sun T, Zhang J

(2020). Nature Communications, 11(1) , 1848. doi: 10.1038/s41467-020-15687-x. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change