compare

Comparison List

stagRFP

stagRFP is a basic (constitutively fluorescent) orange fluorescent protein published in 2020, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.6 kDa -

FPbase ID: QJV5C

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
545 555 113,000 0.53 59.89      

Photostability

No photostability measurements available ... add one!

stagRFP Sequence

stagRFP was derived from TagRFP-T with the following mutations: D159V
amino acid numbers relative to eqFP578. show relative to TagRFP-T

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRTVMALKLVGGGHLICNFKTTYRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: EU582019.1
IPG: EU582019.1

Excerpts

No excerpts have been added for stagRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A rationally enhanced red fluorescent protein expands the utility of FRET biosensors

Mo Gch, Posner C, Rodriguez Ea, Sun T, Zhang J

(2020). Nature Communications, 11(1) , 1848. doi: 10.1038/s41467-020-15687-x. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change